Human IGFBP 3 Protein

SKU: orb426394

Description

Recombinant of human IGFBP 3 protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Escherichia Coli
• Biological Activity: The ED50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 × 103 IU/mg.
• Protein Sequence: GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
• Purity: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: Lyophilized from a 0.2µm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.
• Disclaimer: For research use only

Alternative Names

GH-dependant binding protein, IBP3, BP-53, IGFBP-3.