You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1476887 |
---|---|
Category | Proteins |
Description | Recombinant Human Cation-independent mannose-6-phosphate receptor(IGF2R),partial |
Tag | C-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 20.7 kDa |
UniProt ID | P11717 |
Protein Sequence | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 628-772aa. Protein Length: Partial |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannos Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
≥90% as determined by SDS-PAGE | |
This protein contains the human IGF2R(Met1-Asp1365) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Unconjugated | |
90% | |
34.1 kDa | |
Human IGF-I Protein, Fc Tag is expressed from human 293 cells (HEK293). It contains AA Gly 49 - Ala 118 (Accession # P05019-1). |
ELISA, WB | |
Greater than 90% by SDS-PAGE gel analyses | |
38.6 kDa | |
E.Coli |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
28.1 kDa | |
E.Coli |
98.00% | |
The protein has a predicted MW of 164.90 kDa. Due to glycosylation, the protein migrates to 165-200 kDa based on Tris-Bis PAGE result. |
Filter by Rating