You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359165 |
---|---|
Category | Proteins |
Description | Recombinant human IGF2 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
MW | 7.5 kDa |
UniProt ID | P01344 |
Protein Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Expression System | Expression Region: 25-91aa. Protein Length: Full Length of Mature Protein |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
Expression Region | 25-91aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, with 0.02 % Tween-20 |
Alternative names | IGF-II, T3M-11-derived growth factor, Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human IGF2 protein (Active)
Filter by Rating