Human IGF1R protein

• Catalog Number: orb605341
• Category: Proteins
• Description: Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 21.4 kDa
• UniProt ID: P08069
• Protein Sequence: YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
• Protein Length: Partial
• Source: Yeast
• Expression System: Expression Region: 763-931aa. Protein Length: Partial
• Expression Region: 763-931aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Insulin-like growth factor I receptor Short name,
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.