You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604175 |
---|---|
Category | Proteins |
Description | Recombinant Human Interferon alpha-6(IFNA6) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 25.1 kDa |
UniProt ID | P05013 |
Protein Sequence | SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 21-189aa. Protein Length: Full Length of Mature Protein |
Expression Region | 21-189aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Interferon alpha-54 Interferon alpha-K Short name, Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
21.1 KDa | |
Mammalian |
≥90% as determined by SDS-PAGE | |
This protein contains the human IFNA6(Ser21-Glu189) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
98.00% | |
18 KDa, reducing conditions |
Filter by Rating