Human IFNA2 protein

• Catalog Number: orb594773
• Category: Proteins
• Description: Recombinant Human Interferon alpha-2(IFNA2) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Protein Length: Full Length of Mature Protein
• UniProt ID: P01563
• MW: 19.4 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL.
• Expression Region: 24-188aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-
• Background: At least 23 different variants of IFN-α are known.
• Research Area: Immunology & Inflammation
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.