You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IFNA1 protein
Catalog Number: orb244762
| Catalog Number | orb244762 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Interferon alpha-1/13 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01562 |
| MW | 35.4 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-189aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | IFNA1 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IFNA1 protein (Active) [orb359208]
> 97% as determined by SDS-PAGE and HPLC.
19.5 kDa
E.Coli
100 μg, 500 μg - Item 1 of 1
Human IFNA1 protein (Active) [orb359209]
> 96% as determined by SDS-PAGE and HPLC.
19.5 kDa
E.Coli
100 μg, 500 μg, 10 μg - Item 1 of 1
- Item 1 of 2
- Item 1 of 1
Human IFNA1 Protein, hFc Tag [orb1290870]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 45.5 kDa after removal of the signal peptide. The apparent molecular mass of IFNA1-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg
