You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244762 |
---|---|
Category | Proteins |
Description | Recombinant human Interferon alpha-1/13 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 35.4 kDa |
UniProt ID | P01562 |
Protein Sequence | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 24-189aa. Protein Length: Full Length of Mature Protein |
Expression Region | 24-189aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | IFNA1 Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
19.5 kDa | |
E.Coli |
> 96% as determined by SDS-PAGE and HPLC. | |
19.5 kDa | |
E.Coli |
Unconjugated | |
95% | |
45.8 kDa | |
Human IFN-alpha 1, Fc Tag (orb1147003) is expressed from human 293 cells (HEK293). It contains AA Cys 24 - Glu 189 (Accession # P01562-1). |
Unconjugated | |
95% | |
21.3 kDa | |
Human IFN-alpha 1, His Tag (orb735041) is expressed from human 293 cells (HEK293). It contains AA Cys 24 - Glu 189 (Accession # P01562-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Filter by Rating