Cart summary

You have no items in your shopping cart.

Human IFN a 2a Protein

SKU: orb426358

Description

Recombinant of human IFN a 2a protein

Images & Validation

Application Notes
Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.924 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IFN-a 2a as a Reference Standard

Key Properties

SourceEscherichia Coli
Biological ActivityThe specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg.
Protein SequenceCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. N-terminal methionine has been completely removed enzymatically
PurityGreater than 97.0% as determined by both:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesLyophilized without additives.
DisclaimerFor research use only

Alternative Names

Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.

Similar Products

  • Interferon a [orb1925061]

    CLIA,  ELISA,  LF,  WB

    100 μg
  • Human IFN alpha2a Protein [orb1471756]

    Greater than 95% as determined by reducing SDS-PAGE.

    19.24 KDa

    Mammalian

    50 μg, 10 μg
  • Human Interferon alpha 2 protein [orb753800]

    ELISA,  WB

    Greater than 95% as determined by SDS-PAGE

    18 kDa

    E.Coli

    200 μg, 100 μg, 50 μg, 1 mg
  • Recombinant human Interferon alpha 2 protein, N-His [orb1808048]

    >90% as determined by SDS-PAGE

    21.6 kDa

    20 μg, 100 μg, 500 μg
  • Recombinant Human Interleukin-6 (rHuIL-6) [orb1494960]

    >97% by SDS-PAGE and HPLC analyses.

    Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids.

    Escherichia coli.

    1 mg, 20 μg, 5 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human IFN a 2a Protein (orb426358)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 250.00
100 μg
$ 350.00
1 mg
$ 1,310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry