You have no items in your shopping cart.
Human IFN a 2a Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg. |
| Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. N-terminal methionine has been completely removed enzymatically |
| Purity | Greater than 97.0% as determined by both:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized without additives. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IFN alpha2a Protein [orb1471756]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
19.24 KDa
Mammalian
10 μg, 50 μgRecombinant Human IFN alpha2a Protein [orb3002344]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.24 KDa. Observed: 16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human Interleukin-6 (rHuIL-6) [orb1494960]
>97% by SDS-PAGE and HPLC analyses.
Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids.
Escherichia coli.
1 mg, 5 μg, 20 μgRecombinant human Interferon alpha 2 protein, N-His [orb1808048]
>90% as determined by SDS-PAGE
21.6 kDa
20 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Human IFN a 2a Protein (orb426358)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
