Human HLA-DQB1 protein

SKU: orb604713

Description

This Human HLA-DQB1 protein spans the amino acid sequence from region 33-227aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 33-227aa
• Protein Length: Partial
• MW: 27 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CELIAC1, DQ beta 1 chain, DQB1_HUMAN, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen, DQ beta 1 chain, HLA class II histocompatibility antigen, DQ beta 2 chain, HLA DQB, HLA DQB1, HLA-DQB1, HLA-DQB2, IDDM1, Lymphocyte antigen, Major histocompatibility complex class II beta, Major histocompatibility complex, class II, DQ beta 1, MHC class II antigen DQB1, MHC class II antigen HLA DQ beta 1, MHC class II DQ beta chain, MHC class II HLA DQ beta glycoprotein, MHC class2 antigen, MHC DQ beta, OTTHUMP00000029167, OTTHUMP00000178569, OTTHUMP00000178570, OTTHUMP00000178571

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P01920