You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 3
Item 1 of 3
Human HLA-A protein
Catalog Number: orb604627
| Catalog Number | orb604627 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI |
| Protein Length | Extracellular Domain |
| UniProt ID | P30443 |
| MW | 36.7 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 25-308aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | MHC class I antigen A*1 HLAA |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
- Item 1 of 1
Human HLA-A protein [orb705173]
Greater than 85% as determined by SDS-PAGE.
48.8 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human HLA-A Protein, hFc Tag [orb1291104]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 56.76 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Recombinant human HLA-A & Beta-2-MG Heterodimer protein, His&Avi (HEK293) [orb1975976]
> 90% as determined by SDS-PAGE
35.5 kDa
100 μg, 500 μg - Item 1 of 1
Recombinant Human HLA-A Protein, N-His [orb2832466]
> 90% as determined by SDS-PAGE.
34.12 kDa
100 μg, 50 μg, 20 μg
