You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604627 |
---|---|
Category | Proteins |
Description | Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 36.7 kDa |
UniProt ID | P30443 |
Protein Sequence | GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 25-308aa. Protein Length: Extracellular Domain |
Expression Region | 25-308aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | MHC class I antigen A*1 HLAA Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
48.8 kDa | |
E.coli |
Unconjugated | |
95% | |
48.6 kDa | |
Human LILRB2, His Tag (orb257669) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Val 461 (Accession # AAH36827). |
Filter by Rating