You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 261-345aa |
| Protein Length | Partial |
| MW | 13.4 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human GPRC5D Protein, hFc-His Tag [orb689414]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 31.5 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μgGPRC5D Mouse Monoclonal Antibody [orb2960056]
ELISA, FC
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μgHuman GPRC5D Protein, hFc Tag [orb1173788]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 28.4 kDa after removal of the signal peptide.The apparent molecular mass of GPRC5D-hFc is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgHuman GPRC5D full length protein-exo [orb1291764]
Unconjugated
The human full length GPRC5D Protein has a MW of 38.6 kDa
Mammalian
100 μg, 50 μgTalquetamab Human Monoclonal Antibody [orb2978082]
ELISA, FA, FACS, In vivo
Human
Human Humanized
Monoclonal
Unconjugated
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human GPRC5D Protein (orb1477651)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













