Human GPR75 protein

Catalog Number: orb358239

Catalog Number	orb358239
Category	Proteins
Description	Recombinant human GPR75 protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	20.9 kDa
UniProt ID	O95800
Protein Sequence	NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV
Protein Length	Cytoplasmic Domain
Source	Yeast
Expression System	Expression Region: 372-540aa. Protein Length: Cytoplasmic Domain
Expression Region	372-540aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	G protein coupled receptor 75, GPR chr2, Gpr75, GP Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 31.0 kDa after removal of the signal peptide. The apparent molecular mass of GPR75-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 10 μg, 50 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 31.1 kDa after removal of the signal peptide. The apparent molecular mass of GPR75-mFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Human GPR75 full length protein-synthetic nanodisc [orb1743239]
MW:
The human full length GPR75 protein has a MW of 59.4 kDa
Source:
Mammalian
Sizes Available: 10 μg, 50 μg, 100 μg
GPR75 siRNA (Human) [orb1860799]
Applications:
RNA-I
Sizes Available: 30 nmol, 15 nmol
GPR75 Human Over-expression Lysate [orb1347185]
Sizes Available: 100 μg

MW:	The human full length GPR75 protein has a MW of 59.4 kDa
Source:	Mammalian