Human GP1BB protein

Catalog Number: orb595166

Catalog Number	orb595166
Category	Proteins
Description	Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)
Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	39.3 kDa
UniProt ID	P13224
Protein Sequence	CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Protein Length	Full Length of Mature Protein
Source	in vitro E.coli expression system
Expression System	Expression Region: 26-206aa. Protein Length: Full Length of Mature Protein
Expression Region	26-206aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Antigen CD42b-beta CD_antigen, CD42c Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 39.0 kDa after removal of the signal peptide. The apparent molecular mass of GP1BB-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 10 μg, 50 μg

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human GP1BB(Met1-Cys147) was fused with the C-terminal His Tag and expressed in Mammalian cells.

Applications:	ELISA, WB
Purity:	Greater than 95% as determined by SDS-PAGE
MW:	19.8 kDa
Source:	E.Coli

Purity:	98.00%
MW:	The protein has a predicted MW of 39.6 kDa. Due to glycosylation, the protein migrates to 47-50 kDa based on Tris-Bis PAGE result.