Human GP1BA protein

Catalog Number: orb604132

Catalog Number	orb604132
Category	Proteins
Description	Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	15.9 kDa
UniProt ID	P07359
Protein Sequence	SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 553-652aa. Protein Length: Partial
Expression Region	553-652aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Antigen CD42b-alpha CD_antigen, CD42b Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	83.9 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	57.9 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	58.9 kDa
Source:	Yeast

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human GP1BA(Met1-Leu531) was fused with the C-terminal His Tag and expressed in Mammalian cells.

Purity:	SDS-PAGE: 96.7%; SEC-HPLC: 100%
MW:	56.7 kDa (predicted)