You have no items in your shopping cart.
Human GMFB Protein
SKU: orb425791
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH |
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
| Disclaimer | For research use only |
Alternative Names
−Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Similar Products
−- Item 1 of 1
Human Glia Maturation Factor, Beta (GMFB) ELISA Kit [orb1948558]
Human
31.25-2000pg/mL
18.75 pg/mL
48 T, 96 T GMF beta (GMFB) (NM_004124) Human Recombinant Protein [orb3051068]
> 80% as determined by SDS-PAGE and Coomassie blue staining
16.5 kDa
100 μg, 20 μg, 1 mgRecombinant Human GMFB Protein, N-His [orb2964551]
>90% as determined by SDS-PAGE.
18.88 kDa
1 mg, 100 μg, 50 μgHuman GMFB protein [orb1292297]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
37.4 KDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgHuman GMFB protein [orb391810]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
50 μg, 10 μg, 500 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human GMFB Protein (orb425791)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days