You have no items in your shopping cart.
Human Genome poly protein
SKU: orb419139
Featured
Description
Research Area
Epigenetics, Infectious Diseases, Non-Animal
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89) |
| Tag | N-terminal 10xHis-tagged |
| Molecular Weight | 38.1 kDa |
| Expression Region | 575-866aa |
| Protein Length | Partial |
| Protein Sequence | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Genome polyprotein [Cleaved into, P1, Capsid protein VP0, VP4-VP2), Capsid protein VP4, P1A, Virion protein 4), Capsid protein VP2, P1B, Virion protein 2), Capsid protein VP3, P1C, Virion protein 3), Capsid protein VP1, P1D, Virion protein 1), P2, Protease 2A, P2A, EC 3.4.22.29, Picornain 2A, Protein 2A), Protein 2B, P2B), Protein 2C, P2C, EC 3.6.1.15), P3, Protein 3AB, Protein 3A, P3A), Viral protein genome-linked, VPg, Protein 3B, P3B), Protein 3CD, EC 3.4.22.28), Protease 3C, EC 3.4.22.28, Picornain 3C, P3C), RNA-directed RNA polymerase, RdRp, EC 2.7.7.48, 3D polymerase, 3Dpol, Protein 3D, 3D)]

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human Genome poly protein (orb419139)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review