Human Genome poly protein

SKU: orb419139

Description

This Human Genome poly protein spans the amino acid sequence from region 575-866aa. Purity: Greater than 85% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Tag Info: N-terminal 10xHis-taggedExpression Region: 575-866aaSequence Info: Full Length of Mature Protein

Key Properties

• Source: E.coli
• Biological Origin: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
• Tag: N-terminal 10xHis-tagged
• Molecular Weight: 38.1 kDa
• Expression Region: 575-866aa
• Protein Length: Partial
• Protein Sequence: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Genome polyprotein [Cleaved into, P1, Capsid protein VP0, VP4-VP2), Capsid protein VP4, P1A, Virion protein 4), Capsid protein VP2, P1B, Virion protein 2), Capsid protein VP3, P1C, Virion protein 3), Capsid protein VP1, P1D, Virion protein 1), P2, Protease 2A, P2A, EC 3.4.22.29, Picornain 2A, Protein 2A), Protein 2B, P2B), Protein 2C, P2C, EC 3.6.1.15), P3, Protein 3AB, Protein 3A, P3A), Viral protein genome-linked, VPg, Protein 3B, P3B), Protein 3CD, EC 3.4.22.28), Protease 3C, EC 3.4.22.28, Picornain 3C, P3C), RNA-directed RNA polymerase, RdRp, EC 2.7.7.48, 3D polymerase, 3Dpol, Protein 3D, 3D)]

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P07210