You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb705305 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Growth/differentiation factor 7(GDF7) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Purity | > 95 % as determined by SDS-PAGE and HPLC analyses. |
| Protein Sequence | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q7Z4P5 |
| MW | 14.0 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 0.1 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
| Expression Region | 322-450aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | GDF-7, BMP12 |
| Research Area | Signal Transduction |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human | |
62.5-4000pg/mL | |
37.5 pg/mL |
>90% as determined by SDS-PAGE. | |
16.32 kDa |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review