You have no items in your shopping cart.
Human GDF5 protein
SKU: orb705307
Featured
Active
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 13.6 kDa |
| Expression Region | 382-501aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Purity | > 95 % as determined by SDS-PAGE and HPLC analyses. |
| Endotoxins | Less than 0.1 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin
Similar Products
−Human Growth Differentiation Factor 5 (GDF5) ELISA Kit [orb775191]
Human
78.13-5000 pg/mL
32 pg/mL
96 T, 48 THuman GDF5(Growth Differentiation Factor 5) Microsample ELISA Kit [orb2999057]
Human
78.13-5000 pg/mL
32 pg/mL
48 T, 96 TRecombinant Human Growth/differentiation factor 5 (GDF5) [orb2659167]
Greater than 85% as determined by SDS-PAGE.
20.5 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human GDF5 protein (orb705307)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






