You have no items in your shopping cart.
Cart summary
Human Frizzled-1 protein
Catalog Number: orb1215809
| Catalog Number | orb1215809 |
|---|---|
| Category | Proteins |
| Description | The Human Frizzled-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human Frizzled-1 applications are for cell culture, ELISA standard, and Western Blot Control. Human Frizzled-1 yeast-derived recombinant protein can be purchased in multiple sizes. Human Frizzled-1 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178)) (Gene ID: 8321). |
| Target | Frizzled-1 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178) |
| Protein Length | 178 |
| MW | 19.4 kDa |
| Source | Yeast |
| Biological Origin | Human |
| Storage | -20°C |
| Note | For research use only |
Human FZD1-Strep full length protein-synthetic nanodisc [orb2668831]
The human full length FZD1-Strep protein has a MW of 71.2 kDa
100 μg, 50 μg, 10 μgHuman FZD1 full length protein-synthetic nanodisc [orb1826623]
The human full length FZD1 protein has a MW of 71.2kDa
Mammalian
10 μg, 50 μg, 100 μgRecombinant Human Frizzled-1 Protein, Fc & His Tag [orb1551089]
> 92% by SDS-PAGE.
Recombinant Human Frizzled-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln73-His Tag253) of human Frizzled-1 (Accession #NP_003496.1) fused with an Fc, 6��His Tag at the C-terminus.
100 μg, 50 μg
