Human FOxM1 protein

• Catalog Number: orb10024
• Category: Proteins
• Description: Recombinant of human FOxM1 protein
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
• Protein Length: Partial
• UniProt ID: Q08050
• RRID: AB_10753466
• MW: 31.2 kDa
• Application notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 235-327aaSequence Info: PartialGlycerol content: 0.5
• Endotoxins: Not test.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Expression Region: 235-327aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Forkhead-related protein FKHL16 Hepatocyte nuclear
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.