You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594976 |
---|---|
Category | Proteins |
Description | Recombinant Human Folate receptor beta(FOLR2),partial |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 27.1 kDa |
UniProt ID | P14207 |
Protein Sequence | CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN |
Protein Length | Partial |
Source | Baculovirus |
Biological Origin | Homo sapiens (Human) |
Expression Region | 19-230aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Folate receptor 2 Folate receptor, fetal/placental Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.7 kDa after removal of the signal peptide.The apparent molecular mass of FOLR2-mFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 25.4 kDa after removal of the signal peptide. The apparent molecular mass of FOLR2-His is approximately 25-35 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
50.7 kDa | |
HEK293 |