You have no items in your shopping cart.
Cart summary
Human FN1 protein
Catalog Number: orb594929
| Catalog Number | orb594929 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fibronectin(FN1),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 62.7 kDa |
| UniProt ID | P02751 |
| Protein Sequence | PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS&AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
| Protein Length | Dimer |
| Source | E.coli |
| Expression System | Expression Region: 1270-1546aa & 1721-2016aa. Protein Length: Dimer |
| Biological Activity | The ED50 as determined by its ability to support cell attachment and spreading when used as a substratum for cell culture is 0.1-0.5 μg/ml. |
| Expression Region | 1270-1546aa & 1721-2016aa |
| Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 12.5 mM Citric acid, 1.25% Sucrose, 0.1% Tween80, pH 5.5 . |
| Alternative names | NovoNectin;Fibronectin; FN; Cold-insoluble globuli Read more... |
| Note | For research use only |
| Application notes | Dimer |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human Fibronectin protein [orb705290]
Greater than 90% as determined by SDS-PAGE.
23.6 kDa
E.coli
20 μg, 100 μg, 1 mgHuman FN1 Protein, His Tag [orb1173672]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 270.1 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μgHuman FN1 protein [orb706944]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgHuman FN1 protein [orb391756]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
