Cart summary

You have no items in your shopping cart.

Human FLT1 D3 Protein

SKU: orb425549

Description

Recombinant of human FLT1 D3 protein

Images & Validation

Application Notes
Protein Kinases

Key Properties

SourceInsect Cells
Biological ActivityThe activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Protein SequenceSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
PurityGreater than 90.0% as determined by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesFLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.
DisclaimerFor research use only

Alternative Names

FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1.

Similar Products

  • Human FLT1 D3 (His) Protein [orb425550]

    Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

    Insect Cells

    1 mg, 10 μg, 2 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human FLT1 D3 Protein (orb425549)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

2 μg
$ 250.00
10 μg
$ 350.00
100 μg
$ 1,440.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry