Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human FGFR2 Protein

SKU: orb425518

Description

Recombinant of human FGFR2 protein

Research Area

Cell Biology

Images & Validation

Application Notes
10X Buffer with MgSO4: default

Key Properties

SourceInsect Cells
Biological ActivityDetermined by its ability to inhibit human FGF-2 dependent proliferation on HUVE cells. The ED50 for this effect is typically at 15 - 30ng/ml.
PurityGreater than 90.0% as determined by SDS-PAGE.
Protein SequenceRPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWT KDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVT DAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKF RCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNY TCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVT FEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEDPRRASIE GRGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage & Handling

StorageStability: Lyophilized FGFR2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGFR2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesCD332 was lyophilized from a concentrated (1 mg/ml) sterile solution containing no additives.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Keratinocyte growth factor receptor 2, CD332, FGFR2.

Similar Products

  • Recombinant Human FGFR2IIIb Protein [orb2993042]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC.(QC verified)

    Predicted: 26.2 KDa. Observed: 40-70 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human FGFR2IIIc Protein [orb2993043]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)

    Predicted: 66.5 KDa. Observed: 85-120 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human FGFR2IIIb Protein [orb2993044]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)

    Predicted: 52.3 KDa. Observed: 70-90 KDa, reducing conditions

    50 μg, 500 μg, 1 mg, 10 μg
  • Recombinant Human FGFR2 beta Protein [orb2993025]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 52.2 KDa. Observed: 72-95 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human FGFR2IIIb Protein [orb2993041]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 66.5 KDa. Observed: 85-120 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

2 μg
$ 250.00
10 μg
$ 350.00
1 mg
$ 6,790.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry