You have no items in your shopping cart.
Human FGFR2 Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Insect Cells |
|---|---|
| Biological Activity | Determined by its ability to inhibit human FGF-2 dependent proliferation on HUVE cells. The ED50 for this effect is typically at 15 - 30ng/ml. |
| Protein Sequence | RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWT KDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVT DAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKF RCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNY TCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVT FEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEDPRRASIE GRGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Purity | Greater than 90.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized FGFR2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGFR2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | CD332 was lyophilized from a concentrated (1 mg/ml) sterile solution containing no additives. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human FGFR2 Protein, His Tag [orb1826867]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.6 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman FGFR2 Protein, His Tag [orb1826772]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of FGFR2-His is approximately 55-100 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Human CD332/FGFR2 Protein, C-His [orb2968926]
>90% as determined by SDS-PAGE.
42.78 kDa
1 mg, 100 μg, 50 μgRecombinant Human CD332/FGFR2 Protein, N-His [orb2968927]
>90% as determined by SDS-PAGE.
41.84 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Request a Document
Protocol Information
Human FGFR2 Protein (orb425518)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

