You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594735 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibroblast growth factor 9(FGF9) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5% Trehalos, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Protein Length | Full Length |
UniProt ID | P31371 |
MW | 23.44 kDa |
Application notes | Full Length |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 1-5 ng/ml. |
Expression Region | 1-208aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Fibroblast Growth Factor 9; FGF-9; Glia-Activating Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by SDS-PAGE and HPLC. | |
23.3 kDa | |
E.Coli |
Greater than 95% as determined by reducing SDS-PAGE. | |
23.44 KDa | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
> 90% as determined by SDS-PAGE. | |
25.75 kDa |
> 90% as determined by SDS-PAGE. | |
50.97 kDa |