Human FGF4 protein

Catalog Number: orb594752

Catalog Number	orb594752
Category	Proteins
Description	Recombinant Human Fibroblast growth factor 4(FGF4),partial (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	16.9 kDa
UniProt ID	P08620
Protein Sequence	SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 54-206aa. Protein Length: Partial
Biological Activity	The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.
Expression Region	54-206aa
Endotoxins	Less than 0.01 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered PBS, 500mM NaCl, pH 7.4.
Alternative names	Fibroblast growth factor 4; FGF-4; Heparin secreto Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	44.2 kDa
Source:	Human Gremlin, Fc Tag (orb18285) is expressed from human 293 cells (HEK293). It contains AA Lys 25 - Asp 184 (Accession # NP_037504).

Purity:	> 96% as determined by SDSPAGE and HPLC.
MW:	19.8 kDa
Source:	E.Coli