Human FGF4 protein

SKU: orb594752

Description

This Human FGF4 protein spans the amino acid sequence from region 54-206aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 16.9 kDa
• Expression Region: 54-206aa
• Protein Length: Partial
• Protein Sequence: SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Disclaimer: For research use only

Alternative Names

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P08620