You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605324 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibroblast growth factor 2(FGF2) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Protein Length | Full Length of Mature Protein |
UniProt ID | P09038 |
MW | 17.9 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 143-288aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Basic fibroblast growth factor (bFGF) (Heparin-bin Read more... |
Note | For research use only |
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
Greater than 95% as determined by reducing SDS-PAGE. | |
17.2 KDa | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
32.4 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
17.4 kDa | |
E.coli |