You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human FGF2 protein
Catalog Number: orb605324
| Catalog Number | orb605324 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fibroblast growth factor 2(FGF2) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P09038 |
| MW | 17.9 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 143-288aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Basic fibroblast growth factor (bFGF) (Heparin-bin Read more... |
| Note | For research use only |
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.
- Item 1 of 1
- Item 1 of 1
Human FGFb (Q65I,C96S,N111G) Protein [orb1471749]
Greater than 95% as determined by reducing SDS-PAGE.
17.2 KDa
Mammalian
50 μg, 10 μg - Item 1 of 1
Human FGF2 Protein, Flag Tag [orb2321459]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human FGF2 protein [orb604091]
Greater than 90% as determined by SDS-PAGE.
32.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human FGF2 protein [orb594729]
Greater than 95% as determined by SDS-PAGE.
17.4 kDa
E.coli
50 μg, 500 μg, 1 mg, 10 μg
