You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604089 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibroblast growth factor 1(FGF1) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 17.8 kDa |
UniProt ID | P05230 |
Protein Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 16-155aa. Protein Length: Full Length of Mature Protein |
Expression Region | 16-155aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Acidic fibroblast growth factor(aFGF) (Endothelial Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
17.5 kDa | |
E.Coli |
> 95% as determined by SDS-PAGE and HPLC. | |
16.0 kDa | |
E.Coli |
Unconjugated | |
95% | |
16.0 kDa | |
Human FGF acidic, Tag Free (orb257176) is expressed from E. coli cells. It contains AA Phe 16 - Asp 155 (Accession # P05230-1). |
Greater than 90% as determined by SDS-PAGE. | |
31.8 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
Filter by Rating