You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb595094 |
---|---|
Category | Proteins |
Description | Recombinant Human Fc receptor-like protein 6(FCRL6),partial |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 34.2 kDa |
UniProt ID | Q6DN72 |
Protein Sequence | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW |
Protein Length | Extracellular Domain |
Source | Baculovirus |
Expression System | Expression Region: 20-307aa. Protein Length: Extracellular Domain |
Expression Region | 20-307aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Fc receptor homolog 6 (FcRH6) (IFGP6) Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
35.2 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
33.7 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
35.7 kDa | |
E.coli |
Filter by Rating