You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb382950 |
---|---|
Category | Proteins |
Description | Recombinant human FCER1G protein. |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34.8 kDa |
UniProt ID | P30273 |
Protein Sequence | LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 19-86aa. Protein Length: Full Length of Mature Protein |
Expression Region | 19-86aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Fc receptor gamma-chain , FcRgammaFc-epsilon RI-ga Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal GST-tagged Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
53.0 kDa | |
Human NKp46, Fc Tag (orb257704) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Asn 254 (Accession # AAH64806). |
Greater than 90% as determined by SDS-PAGE. | |
6.9 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
18.9 kDa | |
E.coli |
Unconjugated | |
90% | |
28.3 kDa | |
Human NKp46, His Tag (orb612114) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Asn 254 (Accession # AAH64806.1). |
Biotin | |
95% | |
28.3 kDa | |
Biotinylated Human NKp46 Protein, His Tag, primary amine labeling (orb867317) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Asn 254 (Accession # O76036-6). |
Filter by Rating