You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383185 |
---|---|
Category | Proteins |
Description | Recombinant human FCER1A protein. |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 37 kDa |
UniProt ID | P12319 |
Protein Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 26-205aa. Protein Length: Extracellular Domain |
Expression Region | 26-205aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | c-epsilon RI-alpha Short name, FcERI IgE Fc recept Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
23 kDa | |
Yeast |
Unconjugated | |
95% | |
49.0 kDa | |
Cynomolgus LILRB1, His Tag (orb1149296) is expressed from human 293 cells (HEK293). It contains AA Gly 41 - His 474 (Accession # XP_045236898.1). |
98.00% | |
The protein has a predicted MW of 22.1 kDa. Due to glycosylation, the protein migrates to 48-65 kDa based on Tris-Bis PAGE result. |
Filter by Rating