You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 26-205aa |
| Protein Length | Extracellular Domain |
| MW | 37 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−c-epsilon RI-alpha Short name, FcERI IgE Fc receptor subunit alpha
Similar Products
−FCER1A Mouse Monoclonal Antibody [orb2959076]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μgHuman FCER1A protein [orb383213]
Greater than 90% as determined by SDS-PAGE.
23 kDa
Yeast
100 μg, 20 μg, 1 mgRecombinant human FCER1A protein, C-His-Avi (HEK293) [orb1974306]
>90% as determined by SDS-PAGE
1.6 kDa
500 μg, 100 μg, 20 μgRecombinant Human FCER1A Protein, N-His [orb2965301]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
21.61 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide







