You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245832 |
---|---|
Category | Proteins |
Description | Recombinant human Tumor necrosis factor ligand superfamily member 6 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 22.4 kDa |
UniProt ID | P48023 |
Protein Sequence | QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Protein Length | Extracellular Domain |
Source | Yeast |
Expression System | Expression Region: 103-281aa. Protein Length: Extracellular Domain |
Expression Region | 103-281aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | FASLG Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
> 95% as determined by SDS-PAGE and HPLC. | |
17.6 kDa | |
E.Coli |
Greater than 85% as determined by SDS-PAGE. | |
40.6 kDa | |
in vitro E.coli expression system |
Human | |
31.25 pg/mL-2000 pg/mL | |
7.81 pg/mL |
Greater than 90% as determined by SDS-PAGE. | |
19.3 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
24.4 kDa | |
E.coli |
Filter by Rating