You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383030 |
---|---|
Category | Proteins |
Description | Recombinant human F11 protein. |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 45.2 kDa |
UniProt ID | P03951 |
Protein Sequence | ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 19-387aa. Protein Length: Partial |
Expression Region | 19-387aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Plasma thromboplastin antecedent Short name, PTA C Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
69.9 kDa | |
Human Coagulation factor XI, His Tag (orb668876) is expressed from human 293 cells (HEK293). It contains AA Glu 19 - Val 625 (Accession # P03951-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
≥90% as determined by SDS-PAGE | |
This protein contains the human F11R(Met1-Val238) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
≥90% as determined by SDS-PAGE | |
This protein contains the human F11R(Ser28-Val238) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating