You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604081 |
---|---|
Category | Proteins |
Description | Recombinant Human Ezrin(EZR),partial |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 45.4 kDa |
UniProt ID | P15311 |
Protein Sequence | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 1-251aa. Protein Length: Partial |
Expression Region | 1-251aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CytovillinVillin-2p81 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
ICC, IF, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Unconjugated | |
95% | |
10.4 kDa | |
Human S100P, Tag Free (orb257820) is expressed from E.coli cells. It contains AA Met 1 - Lys 95 (Accession # AAH06819). |
Greater than 90% as determined by SDS-PAGE. | |
31.4 kDa | |
Yeast |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Human | |
0.312 ng/mL-20 ng/mL | |
0.078 ng/mL |
Filter by Rating