You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ESAM protein
Catalog Number: orb244917
| Catalog Number | orb244917 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Endothelial cell-selective adhesion molecule |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA |
| Protein Length | Extracellular Domain |
| UniProt ID | Q96AP7 |
| MW | 39.8 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 30-248aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | ESAM |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human ESAM protein [orb391683]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman ESAM protein [orb391684]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman ESAM Protein, Fc Tag [orb2697321]
> 95%, determined by reduced SDS-PAGE
This protein contains (Met 1-Ala 248) of human ESAM (NP_6204112) precursor was expressed with the fused Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
1 mg, 100 μgHuman ESAM Protein, Fc Tag [orb2701785]
> 92%, determined by SDS-PAGE
The mature form of human ESAM (NP_620411.2) extracellular domain (Met 1-Ala 248) with five amino acids (DDDDK) at the C-terminus was expressed from HEK293 Cells.
100 μg, 50 μgHuman ESAM Protein, His Tag [orb2701786]
> 97%, determined by SDS-PAGE
This protein contains the extracellular domain (Met 1-Ala 248) of human ESAM (NP_620411.2) precursor was expressed from HEK293 Cells.
100 μg, 50 μg
