You have no items in your shopping cart.
Cart summary
Human EFNA5 protein
Catalog Number: orb624106
| Catalog Number | orb624106 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Ephrin-A5 protein |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| MW | 50.1 kDa |
| UniProt ID | P52803 |
| Protein Sequence | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Expression System | Expression Region: 21-203aa. Protein Length: Full Length of Mature Protein |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. |
| Expression Region | 21-203aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | AL-1 (EPH-related receptor tyrosine kinase ligand Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human EFNA5 protein [orb391647]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human Ephrin-A5/EFNA5 Protein, Fc & His Tag [orb1551314]
> 92% by SDS-PAGE.
KMP1173, Recombinant Human Ephrin-A5/EFNA5 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn203) of human Ephrin-A5/EFNA5 (Accession #NP_001953.1) fused with an Fc, 6×His Tag at the C-terminus.
50 μg, 100 μgRecombinant Human EPHRIN-A5/EFNA5 Protein, Fc Tag [orb1552474]
≥90% as determined by SDS-PAGE
This protein contains the human EFNA5(Gln21-Asn203) was fused with the C-terminal Fc Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
