Human EFNA5 protein

SKU: orb624106

Description

This Human EFNA5 protein spans the amino acid sequence from region 21-203aa. Purity: Greater than 93% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.
• Tag: C-terminal hFc1-tagged
• Molecular Weight: 50.1 kDa
• Expression Region: 21-203aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Purity: Greater than 93% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.

Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay.

Quick Database Links

UniProt

P52803