You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419022 |
---|---|
Category | Proteins |
Description | RecombinantHumanCytochromeb-245heavychain |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 35.2 kDa |
UniProt ID | P04839 |
Protein Sequence | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Protein Length | Partial |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 283-570aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CGD91-phox Cytochrome b(558) subunit beta Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 283-570aaSequence Info: Full Length |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CYBB.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CYBB.
Greater than 90% as determined by SDS-PAGE. | |
49.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
37.2 kDa | |
E.coli |
85.00% | |
65.5 kDa (predicted) |