You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CXCL8 protein
Catalog Number: orb604197
| Catalog Number | orb604197 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-8(CXCL8),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 13.0 kDa |
| UniProt ID | P10145 |
| Protein Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 23-99aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | C-X-C motif chemokine hemokine (C-X-C motif) ligan Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human IL8 Protein, hFc Tag [orb1291089]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of hFc-IL8 is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human IL-8 (C-6His) Protein [orb1471732]
Greater than 95% as determined by reducing SDS-PAGE.
10.1 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human CXCL8 protein [orb605346]
Greater than 85% as determined by SDS-PAGE.
10.9 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human IL8 Protein, His Tag [orb1743381]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 9.2 kDa after removal of the signal peptide. The apparent molecular mass of IL8-His is approximately 10-15 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
