You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CX3CL1 protein
Catalog Number: orb244148
| Catalog Number | orb244148 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Fractalkine |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
| Protein Length | Partial |
| UniProt ID | P78423 |
| MW | 24.6 kDa |
| Application notes | Chemokine domain of His-SUMO-tag and expression region is 25-100aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 25-100aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CX3CL1 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 2
Human CX3CL1 Protein, His Tag [orb1826766]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.4 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human CX3CL1 protein [orb391582]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
