You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604001 |
---|---|
Category | Proteins |
Description | Recombinant Human Connective tissue growth factor(CTGF),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 15.1 kDa |
UniProt ID | P29279 |
Protein Sequence | GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 253-349aa. Protein Length: Partial |
Expression Region | 253-349aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CCN family member 2Hypertrophic chondrocyte-specif Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
61.9 kDa | |
Human CTGF, Fc Tag (orb867319) is expressed from human 293 cells (HEK293). It contains AA Gln27-Ala349 (Accession # Q5M8T4-1 ). |
Unconjugated | |
90% | |
37.3 kDa | |
Rhesus macaque CTGF, His Tag (orb668877) is expressed from human 293 cells (HEK293). It contains AA Gln 27 - Ala 349 (Accession # H9FQD5-1). |
Unconjugated | |
90% | |
37.3 kDa | |
Mouse CTGF, His Tag (orb545763) is expressed from human 293 cells (HEK293). It contains AA Gln 26 - Ala 348 (Accession # P29268-1). |
Unconjugated | |
90% | |
37.4 kDa | |
Human CTGF, His Tag (orb545757) is expressed from human 293 cells (HEK293). It contains AA Gln 27 - Ala 349 (Accession # Q5M8T4-1). |
Greater than 90% as determined by SDS-PAGE. | |
36.3 kDa | |
E.coli |
Filter by Rating