You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54585 |
---|---|
Category | Proteins |
Description | Recombinant human CT83 protein |
Tag | N-terminal 6xHis-B2M-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Protein Length | Full Length |
UniProt ID | Q5H943 |
MW | 26.8 kDa |
Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-B2M-tagged1-113AA: 1-113AAFull Length: Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-113aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Cancer/testis antigen 83 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CT83.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CT83.
Greater than 90% as determined by SDS-PAGE. | |
14.8 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
58.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
11.2 kDa | |
E.coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.7 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CT83 is approximately 25-35 kDa due to glycosylation. | |
Mammalian |
98.00% | |
14.0 kDa (predicted) |