You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594717 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Granulocyte colony-stimulating factor(CSF3),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Protein Length | Partial of Isoform 2 |
| UniProt ID | P09919 |
| MW | 18.8 kDa |
| Application notes | Partial of Isoform 2 |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml. |
| Expression Region | 31-204aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Granulocyte Colony-Stimulating Factor; G-CSF; Plur Read more... |
| Research Area | Cancer Biology |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human | |
39.06-2500pg/mL | |
13 pg/mL |
> 98% as determined by SDS-PAGE and HPLC. | |
18.7 kDa | |
E.Coli |
IHC-P | |
Human | |
Mouse | |
Recombinant | |
Unconjugated |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review