You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594717 |
---|---|
Category | Proteins |
Description | Recombinant Human Granulocyte colony-stimulating factor(CSF3),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Protein Length | Partial of Isoform 2 |
UniProt ID | P09919 |
MW | 18.8 kDa |
Application notes | Partial of Isoform 2 |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml. |
Expression Region | 31-204aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Granulocyte Colony-Stimulating Factor; G-CSF; Plur Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 98% as determined by SDS-PAGE and HPLC. | |
18.7 kDa | |
E.Coli |
IF, IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |