You have no items in your shopping cart.
Human CSF1 protein
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 26.17 kDa |
| Expression Region | 33-255aa |
| Protein Length | Partial |
| Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human CSF1 protein (Active) [orb359033]
> 95% as determined by SDS-PAGE and HPLC.
18.4 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman CSF1 protein [orb605310]
Greater than 90% as determined by SDS-PAGE.
19.9 kDa
Yeast
1 mg, 20 μg, 100 μgHuman M-CSF (C-6His) Protein [orb1471781]
Greater than 95% as determined by reducing SDS-PAGE.
26.17 KDa
Mammalian
10 μg, 50 μgHuman CSF1 protein [orb605309]
Greater than 90% as determined by SDS-PAGE.
58.9 kDa
Yeast
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CSF1 protein (orb594716)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






