You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594716 |
---|---|
Category | Proteins |
Description | Recombinant Human Macrophage colony-stimulating factor 1(CSF1),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR |
Protein Length | Partial |
UniProt ID | P09603 |
MW | 26.17 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. |
Expression Region | 33-255aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Macrophage Colony-Stimulating Factor 1; CSF-1; M-C Read more... |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 95% as determined by SDS-PAGE and HPLC. | |
18.4 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
19.9 kDa | |
Yeast |
Greater than 95% as determined by reducing SDS-PAGE. | |
26.17 KDa | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
58.9 kDa | |
Yeast |
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. |