You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CSF1 protein
Catalog Number: orb594716
| Catalog Number | orb594716 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Macrophage colony-stimulating factor 1(CSF1),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR |
| Protein Length | Partial |
| UniProt ID | P09603 |
| MW | 26.17 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. |
| Expression Region | 33-255aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Macrophage Colony-Stimulating Factor 1; CSF-1; M-C Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human CSF1 protein (Active) [orb359033]
> 95% as determined by SDS-PAGE and HPLC.
18.4 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Human CSF1 protein [orb605310]
Greater than 90% as determined by SDS-PAGE.
19.9 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 2
Human M-CSF (C-6His) Protein [orb1471781]
Greater than 95% as determined by reducing SDS-PAGE.
26.17 KDa
Mammalian
10 μg, 50 μg - Item 1 of 2
Recombinant human CSF1R protein, C-His-Avi (HEK293) [orb1516472]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 2
Recombinant human CSF1R protein, C-His-Avi (HEK293), Biotin conjugated [orb2328763]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result.
20 μg
