Human Collagen IV protein

SKU: orb246313

Description

This Human Collagen IV protein spans the amino acid sequence from region 1445-1669aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

• Application Notes:
  Arresten of His-SUMO-tag and expression region is 1445-1669aa

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 1445-1669aa
• Protein Length: Partial
• MW: 40.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Arresten, BSVD, CO4A1_HUMAN, COL4A1, COL4A1 NC1 domain, COL4A2, COL4A3, COL4A4, COL4A5, collagen alpha-1(IV) chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen Of Basement Membrane Alpha 1 Chain, Collagen Of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, collagen type IV alpha 1 chain, Collagen Type IV Alpha 2, Collagen Type IV Alpha 3, Collagen Type IV Alpha 4, Collagen Type IV Alpha 5, RATOR

Quick Database Links

UniProt

P02462