You have no items in your shopping cart.
Featured
Description
Research Area
Cancer Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | in vitro E.coli expression system |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 2853-3176aa |
| Protein Length | Partial |
| MW | 50.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CO6A3_HUMAN, COL6A3, Collagen alpha-3(VI) chain, Collagen type VI alpha 3, Collagen VI alpha 3
Similar Products
−- Item 1 of 1
Recombinant Human COL6A3 Protein, N-His [orb2969211]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
22.9 kDa
1 mg, 50 μg, 100 μg - Item 1 of 1
COL6A3 Mouse Monoclonal Antibody [orb2959077]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 1
Human COL6A3 protein [orb595158]
Greater than 85% as determined by SDS-PAGE.
48.5 kDa
in vitro E.coli expression system
100 μg, 20 μg 
Recombinant Human COL6A3 Protein, N-His [orb2836439]
>90% as determined by SDS-PAGE.
22.91 kDa
20 μg, 50 μg, 100 μg
Collagen VI Recombinant Rabbit mAb, BF350 conjugated [orb3126606]
IF
Human, Mouse, Rat
Rabbit
Recombinant
BF350
100 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks