You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb595157 |
---|---|
Category | Proteins |
Description | Recombinant Human Collagen alpha-3(VI) chain(COL6A3),partial |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG |
Protein Length | Partial |
UniProt ID | P12111 |
MW | 50.5 kDa |
Application notes | Partial |
Endotoxins | Not test. |
Source | in vitro E.coli expression system |
Biological Origin | Homo sapiens (Human) |
Expression Region | 2853-3176aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | CO6A3_HUMAN, COL6A3, Collagen alpha-3(VI) chain, C Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 85% as determined by SDS-PAGE. | |
48.5 kDa | |
in vitro E.coli expression system |
> 90% as determined by SDS-PAGE. | |
22.91 kDa |
98.00% | |
11.4 kDa (predicted); 13.3 kDa (reducing conditions) |