You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human COL6A2 protein
Catalog Number: orb603985
| Catalog Number | orb603985 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Collagen alpha-2 (VI) chain(COL6A2),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR |
| Protein Length | Partial |
| UniProt ID | P12110 |
| MW | 13.4 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 941-1016aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CO6A2_HUMAN, COL6A2, Collagen alpha 2(VI) chain, C Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human COL6A2 protein [orb605206]
Greater than 85% as determined by SDS-PAGE.
37.3 kDa
Mammalian cell
100 μg, 1 mg, 20 μg - Item 1 of 1
Human COL6A2 Protein [orb1478048]
Greater than 85% as determined by SDS-PAGE.
35.2 kDa
E.coli
1 mg, 20 μg, 100 μg 
Recombinant Human COL6A2 Protein, N-His [orb2836440]
> 90% as determined by SDS-PAGE.
41.47 kDa
100 μg, 50 μg, 20 μgRecombinant human COL6A2 Protein,C-His (HEK293) [orb2328583]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μgHuman Collagen VI alpha 2 protein [orb754099]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
24 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μg
