You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603985 |
---|---|
Category | Proteins |
Description | Recombinant Human Collagen alpha-2 (VI) chain(COL6A2),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR |
Protein Length | Partial |
UniProt ID | P12110 |
MW | 13.4 kDa |
Application notes | Partial |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 941-1016aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | CO6A2_HUMAN, COL6A2, Collagen alpha 2(VI) chain, C Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 85% as determined by SDS-PAGE. | |
37.3 kDa | |
Mammalian cell |
Greater than 85% as determined by SDS-PAGE. | |
35.2 kDa | |
E.coli |
> 90% as determined by SDS-PAGE. | |
41.47 kDa |
> 85% as determined by SDS-PAGE |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
24 kDa | |
E.Coli |