You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419134 |
---|---|
Category | Proteins |
Description | Recombinant Human Clusterin |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Protein Length | Full Length of Mature Protein |
UniProt ID | P10909 |
MW | 70.1 kDa |
Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 23-449aaSequence Info: Partial |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 23-449aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Aging-associated gene 4 protein Apolipoprotein J |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLU.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLU.
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.9 kDa after removal of the signal peptide. The apparent molecular mass of CLU-His is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
WB | |
Human | |
Mouse | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |