You have no items in your shopping cart.
Cart summary
Human CLU protein
Catalog Number: orb419134
| Catalog Number | orb419134 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Clusterin |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 70.1 kDa |
| UniProt ID | P10909 |
| Protein Sequence | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Expression System | Expression Region: 23-449aa. Protein Length: Full Length of Mature Protein |
| Expression Region | 23-449aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Aging-associated gene 4 protein Apolipoprotein J Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 23-449aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
- Item 1 of 1
Human Clusterin / CLUS Protein [orb257350]
Unconjugated
95%
50.9 kDa
Human Clusterin, His Tag (orb257350) is expressed from human 293 cells (HEK293). It contains AA Asp 23 - Glu 449 (Accession # NP_001822.3).
1 mg, 100 μg Human CLU protein [orb603980]
Greater than 90% as determined by SDS-PAGE.
27.8 kDa
E.coli
20 μg, 100 μg, 1 mgHuman CLU Protein, His Tag [orb1173859]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 50.9 kDa after removal of the signal peptide. The apparent molecular mass of CLU-His is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgHuman CLU protein [orb391494]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars