You have no items in your shopping cart.
Human CLDN6-VLPs Protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL |
| Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 24.8 kDa |
| Expression Region | 1-220aa |
| Protein Length | Full Length |
| Protein Sequence | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/ml can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL

The presence of VLP-like structures was confirmed by TEM

Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length VLP Protein with an affinity constant of 6.58 nM as detected by MetaSPR Assay (WeSPRTM200).

The purity of VLPs was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CLDN6-VLPs Protein (orb1478125)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review