You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1477118 |
---|---|
Category | Proteins |
Description | Recombinant Human Claudin-4(CLDN4)-VLPs (Active) |
Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
Protein Sequence | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Protein Length | Full Length |
UniProt ID | O14493 |
MW | 23.4 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL. |
Expression Region | 1-209aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | (Clostridium perfringens enterotoxin receptor)(CPE Read more... |
Note | For research use only |
Detected by Mouse anti-6*His monoclonal antibody.
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/ml can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.