You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54413 |
---|---|
Category | Proteins |
Description | Recombinant human CHIA protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 67.1 kDa |
UniProt ID | Q9BZP6 |
Protein Sequence | MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA |
Protein Length | Full Length of Isoform 2 |
Source | E.coli |
Expression System | Expression Region: 1-368aa. Protein Length: Full Length of Isoform 2 |
Expression Region | 1-368aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Lung-specific protein TSA1902 Read more... |
Note | For research use only |
Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-368AAFull Length : Full Length of Isoform 2 |
Expiration Date | 6 months from date of receipt. |
Human | |
0.16-10 ng/mL | |
0.071 ng/mL |
98.00% | |
The protein has a predicted MW of 51.2 kDa. Due to glycosylation, the protein migrates to 55-60 kDa based on Tris-Bis PAGE result. |
Filter by Rating